PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g055480.2.1
Common NameLOC101265545
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 387aa    MW: 43469 Da    PI: 5.2676
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g055480.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.49.6e-52171441128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         l+pGfrFhPtdeelv +yL++kv gk++++ ++++e+d+yk+eP dL   ++vk+++ ewyfFs+ dkky +g+r nrat +gyWkatgkd
  Solyc05g055480.2.1  17 LAPGFRFHPTDEELVRYYLRRKVCGKPFRF-QAVTEIDVYKSEPCDLAgySSVKSRDMEWYFFSPVDKKYCNGSRLNRATGQGYWKATGKD 106
                         579*************************99.88**************85448888999********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ + k++++g+kktLvf++grap+g++t+Wvmheyrl
  Solyc05g055480.2.1 107 RHISH-KSQAIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 144
                         ****9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-6011167IPR003441NAC domain
PROSITE profilePS5100556.41617167IPR003441NAC domain
PfamPF023652.0E-2819144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MEQEGSKGAV TVAPTSLAPG FRFHPTDEEL VRYYLRRKVC GKPFRFQAVT EIDVYKSEPC  60
DLAGYSSVKS RDMEWYFFSP VDKKYCNGSR LNRATGQGYW KATGKDRHIS HKSQAIGMKK  120
TLVFHSGRAP DGKRTNWVMH EYRLADKELE KAGIVQDSFV LCRIFQKSGL GPPTGDRYAP  180
FIEEEWDDDS AVLPGGETED DAVNGVDARV ESNDLDQDAP PKIACDNENV IELRSLPFAC  240
KRERSEEPEL LSLSQNKKPK HDVPSSSRAN GSEDSTITSK DPENMMTTKD YPLALLGFPL  300
LESFEPKDPQ PSNPLTFDSS NLEKSVPPGY LKFISNLETE ILNVSMERET LKIEVMRAQA  360
MINVLQSRID LLTKENEDMR KLVRGG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-501616719168NAC domain-containing protein 19
3swp_C3e-501616719168NAC domain-containing protein 19
3swp_B3e-501616719168NAC domain-containing protein 19
3swp_A3e-501616719168NAC domain-containing protein 19
3swm_D3e-501616719168NAC domain-containing protein 19
3swm_C3e-501616719168NAC domain-containing protein 19
3swm_B3e-501616719168NAC domain-containing protein 19
3swm_A3e-501616719168NAC domain-containing protein 19
4dul_B3e-501616716165NAC domain-containing protein 19
4dul_A3e-501616716165NAC domain-containing protein 19
1ut7_B3e-501616716165NO APICAL MERISTEM PROTEIN
1ut7_A3e-501616716165NO APICAL MERISTEM PROTEIN
1ut4_B3e-501616716165NO APICAL MERISTEM PROTEIN
1ut4_A3e-501616716165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.58200.0flower| fruit| leaf| trichome
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0146260.0Lycopersicon esculentum clone 134129R, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004239709.10.0PREDICTED: NAC domain-containing protein 78
TrEMBLK4C2M40.0K4C2M4_SOLLC; Uncharacterized protein
STRINGSolyc05g055480.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Representative plantOGRP1087158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.12e-95NAC domain containing protein 52
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]